PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0127s0020.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 344aa    MW: 38263 Da    PI: 8.7834
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0127s0020.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.96.8e-52141391128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+v+yL+kkv+g++++l  +i e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg
  SapurV1A.0127s0020.2.p  14 LPPGFRFHPTDEELLVQYLCKKVAGHHFSL-PIIGEIDLYKLDPWFLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATG 99 
                             79**************************99.88***************7777799******************************** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  SapurV1A.0127s0020.2.p 100 TDKVITN-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                             *****99.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-669163IPR003441NAC domain
PROSITE profilePS5100560.23314162IPR003441NAC domain
PfamPF023651.1E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGLQETDPLA QLSLPPGFRF HPTDEELLVQ YLCKKVAGHH FSLPIIGEID LYKLDPWFLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITNEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLL ESSRKSGSTK LDDWVLCRIY KKNSSAAQKS MSGVSSREYS  180
ANCSSPSSSS HLEDVLDSLP EIDDRRFALP RTSPLKPMQH EEKINLANLG SGSFDWATLA  240
GLNSSLPELL QTYPDANYSN TDVNGVCVPS MPPLRHTDSS TERMGNSVEE EVQSGVRTQQ  300
RVGNSGFFQQ NSGAMTPNFS SSFLDPYGFR YSTQPGSGFG FRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-10611687174NAC domain-containing protein 19
3swp_C1e-10611687174NAC domain-containing protein 19
3swp_B1e-10611687174NAC domain-containing protein 19
3swp_A1e-10611687174NAC domain-containing protein 19
3swm_D1e-10611687174NAC domain-containing protein 19
3swm_C1e-10611687174NAC domain-containing protein 19
3swm_B1e-10611687174NAC domain-containing protein 19
3swm_A1e-10611687174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1471420.0EF147142.1 Populus trichocarpa clone WS01228_D08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316917.10.0no apical meristem family protein
SwissprotQ93VY31e-125NAC72_ARATH; NAC domain-containing protein 72
TrEMBLB9HZY30.0B9HZY3_POPTR; No apical meristem family protein
STRINGPOPTR_0011s12400.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-126NAC family protein